API:Action API
| This page is part of the MediaWiki Action API documentation. |
This page provides an overview of the MediaWiki Action API, represented by the api.php endpoint.
This page is intended for technical contributors and software developers who wish to understand and use the MediaWiki Action API.
Quick Start
Get the contents of an article on English Wikipedia in HTML:
Endpoint
All Wikimedia wikis have endpoints that follow this pattern: https://www.example.org/w/api.php
| API Endpoint | Wiki |
|---|---|
https://www.mediawiki.org/w/api.php
|
MediaWiki API |
https://meta.wikimedia.org/w/api.php
|
Meta-Wiki API |
https://en.wikipedia.org/w/api.php
|
English Wikipedia API |
https://nl.wikipedia.org/w/api.php
|
Dutch Wikipedia API |
https://commons.wikimedia.org/w/api.php
|
Wikimedia Commons API |
https://test.wikipedia.org/w/api.php
|
Test Wiki API |
To see the endpoint URL on a particular wiki, see section Entry point URLs on the Special:Version page.
Introduction
The MediaWiki Action API is a web service that allows access to some wiki features like authentication, page operations, and search. It can provide meta information about the wiki and the logged-in user.
Uses for the MediaWiki Action API
- Monitor a MediaWiki installation
- Create a bot to maintain a MediaWiki installation
- Log in to a wiki, access data, and post changes by making HTTP requests to the web service
Getting started with MediaWiki Action API
Before you start using the MediaWiki Action API, you should review the following pages:
- API etiquette and usage guidelines
- Frequently asked questions
- Input and output formats
- Errors and warnings
- Any policies that apply to the wiki you want to access, such as Wikimedia Foundation wikis' terms of use and trademark policy. These terms apply to you when you access or edit using the API, just as they do when you use your web browser.
API documentation
| The following documentation is the output of Special: |
Main module
- Source: MediaWiki
- License: GPL-2.0-or-later
Status: The MediaWiki API is a mature and stable interface that is actively supported and improved. While we try to avoid it, we may occasionally need to make breaking changes; subscribe to the mediawiki-api-announce mailing list for notice of updates.
Erroneous requests: When erroneous requests are sent to the API, an HTTP header will be sent with the key "MediaWiki-API-Error" and then both the value of the header and the error code sent back will be set to the same value. For more information see API: Errors and warnings.
Testing: For ease of testing API requests, see Special:ApiSandbox.
- action
Which action to perform.
- abusefiltercheckmatch
- Check to see if an AbuseFilter matches a set of variables, an edit, or a logged AbuseFilter event.
- abusefilterchecksyntax
- Check syntax of an AbuseFilter filter.
- abusefilterevalexpression
- Evaluates an AbuseFilter expression.
- abusefilterunblockautopromote
- Unblocks a user from receiving autopromotions due to an abusefilter consequence.
- abuselogprivatedetails
- View private details of an AbuseLog entry.
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- aggregategroups
- Manage aggregate message groups.
- antispoof
- Check a username against AntiSpoof's normalisation checks.
- block
- Block a user.
- centralauthtoken
- Fetch a centralauthtoken for making an authenticated request to an attached wiki.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Change authentication data for the current user.
- changecontentmodel
- Change the content model of a page
- checktoken
- Check the validity of a token from action=query&meta=tokens.
- clearhasmsg
- Clears the
hasmsgflag for the current user. - clientlogin
- Log in to the wiki using the interactive flow.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Get the difference between two pages.
- createaccount
- Create a new user account.
- createlocalaccount
- Forcibly create a local account. The central account must exist.
- delete
- Delete a page.
- deleteglobalaccount
- Delete a global user.
- discussiontoolsedit
- Post a message on a discussion page.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- Get the subscription statuses of given topics.
- discussiontoolssubscribe
- Subscribe (or unsubscribe) to receive notifications about a topic.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Mark notifications as read for the current user.
- echomarkseen
- Mark notifications as seen for the current user.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Create and edit pages.
- editmassmessagelist
- Edit a mass message delivery list.
- emailuser
- Email a user.
- expandtemplates
- Expands all templates within wikitext.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Returns a user's contributions feed.
- feedrecentchanges
- Returns a recent changes feed.
- feedthreads
- Return a feed of discussion threads.
- feedwatchlist
- Returns a watchlist feed.
- filerevert
- Revert a file to an old version.
- flow
- Allows actions to be taken on Structured Discussions pages.
- flow-parsoid-utils
- Convert text between wikitext and HTML.
- flowthank
- Send a public thank-you notification for a Flow comment.
- globalblock
- Globally block or unblock a user.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- groupreview
- Set message group workflow states.
- help
- Display help for the specified modules.
- imagerotate
- This module has been disabled.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Search for language names in any script.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- Log out and clear session data.
- managetags
- Perform management tasks relating to change tags.
- markfortranslation
- Mark a page for translation
- massmessage
- Send a message to a list of pages.
- mergehistory
- Merge page histories.
- move
- Move a page.
- newslettersubscribe
- Subscribe to or unsubscribe from a newsletter.
- opensearch
- Search the wiki using the OpenSearch protocol.
- options
- Change preferences of the current user.
- paraminfo
- Obtain information about API modules.
- parse
- Parses content and returns parser output.
- patrol
- Patrol a page or revision.
- protect
- Change the protection level of a page.
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- searchtranslations
- Search translations.
- setglobalaccountstatus
- Hide or lock (or unhide or unlock) a global user account.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- shortenurl
- Shorten a long URL into a shorter one.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Fetch data stored by the TemplateData extension.
- thank
- Send a thank-you notification to an editor.
- threadaction
- Allows actions to be taken on threads and posts in threaded discussions.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- translationaids
- Query all translations aids.
- translationreview
- Mark translations reviewed.
- translationstats
- Fetch translation statistics
- ttmserver
- Query suggestions from translation memories.
- unblock
- Unblock a user.
- undelete
- Undelete revisions of a deleted page.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- webapp-manifest
- Returns a webapp manifest.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- wikilove
- Give WikiLove to another user.
- bouncehandler
- Internal. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Internal. Internal module for the CategoryTree extension.
- chartinfo
- Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-mapping-dump
- Internal. Dump of CirrusSearch mapping for this wiki.
- cirrus-profiles-dump
- Internal. Dump of CirrusSearch profiles for this wiki.
- cirrus-settings-dump
- Internal. Dump of CirrusSearch settings for this wiki.
- collection
- Internal. API module for performing various operations on a wiki user's collection.
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- discussiontoolscompare
- Internal. Get information about comment changes between two page revisions.
- discussiontoolspageinfo
- Internal. Returns metadata required to initialize the discussion tools.
- discussiontoolspreview
- Internal. Preview a message on a discussion page.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- fancycaptchareload
- Internal. Get a new FancyCaptcha.
- focusareaedit
- Internal. Create or update a focus area in the Community Wishlist.
- jsondata
- Internal. Retrieve localized JSON data.
- jsontransform
- Internal. Retrieve JSON data transformed by a Lua function.
- managegroupsynchronizationcache
- Internal. Manage group synchronization cache.
- managemessagegroups
- Internal. Add a message as a rename of an existing message or a new message in the group during imports
- messagegroupsubscription
- Internal. Message group subscription related operations
- oathvalidate
- Internal. Validate a two-factor authentication (OATH) token.
- parser-migration
- Internal. Parse a page with two different parser configurations.
- readinglists
- Internal. Reading list write operations.
- sanitize-mapdata
- Internal. Performs data validation for Kartographer extension
- scribunto-console
- Internal. Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Internal. Prepare an edit in shared cache.
- timedtext
- Internal. Provides timed text content for usage by <track> elements
- translationcheck
- Internal. Validate translations.
- translationentitysearch
- Internal. Search for message groups and messages
- ulslocalization
- Internal. Get the localization of ULS in the given language.
- ulssetlang
- Internal. Update user's preferred interface language.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- wishedit
- Internal. Create or update a wish in the Community Wishlist.
- wishlistvote
- Internal. Support a wish or focus area in the Community Wishlist.
- One of the following values: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, aggregategroups, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedthreads, feedwatchlist, filerevert, flow-parsoid-utils, flow, flowthank, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, groupreview, help, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, markfortranslation, massmessage, mergehistory, move, newslettersubscribe, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, searchtranslations, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, streamconfigs, strikevote, tag, templatedata, thank, threadaction, titleblacklist, torblock, transcodereset, translationaids, translationreview, translationstats, ttmserver, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, wikilove, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-mapping-dump, cirrus-profiles-dump, cirrus-settings-dump, collection, cspreport, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, editcheckreferenceurl, fancycaptchareload, focusareaedit, jsondata, jsontransform, managegroupsynchronizationcache, managemessagegroups, messagegroupsubscription, oathvalidate, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, timedtext, translationcheck, translationentitysearch, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt, wishedit, wishlistvote
- Default: help
- format
The format of the output.
- json
- Output data in JSON format.
- jsonfm
- Output data in JSON format (pretty-print in HTML).
- none
- Output nothing.
- php
- Output data in serialized PHP format.
- phpfm
- Output data in serialized PHP format (pretty-print in HTML).
- rawfm
- Output data, including debugging elements, in JSON format (pretty-print in HTML).
- xml
- Output data in XML format.
- xmlfm
- Output data in XML format (pretty-print in HTML).
- One of the following values: json, jsonfm, none, php, phpfm, rawfm, xml, xmlfm
- Default: jsonfm
- maxlag
Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.- Type: integer
- smaxage
Set the
s-maxageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- maxage
Set the
max-ageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- assert
Verify that the user is logged in (including possibly as a temporary user) if set to user, not logged in if set to anon, or has the bot user right if bot.
- One of the following values: anon, bot, user
- assertuser
Verify the current user is the named user.
- Type: user, by any of username and Temporary user
- requestid
Any value given here will be included in the response. May be used to distinguish requests.
- servedby
Include the hostname that served the request in the results.
- Type: boolean (details)
- curtimestamp
Include the current timestamp in the result.
- Type: boolean (details)
- responselanginfo
Include the languages used for uselang and errorlang in the result.
- Type: boolean (details)
- origin
When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URI (not the POST body).
For authenticated requests, this must match one of the origins in the
Originheader exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match theOriginheader, a 403 response will be returned. If this parameter matches theOriginheader and the origin is allowed, theAccess-Control-Allow-OriginandAccess-Control-Allow-Credentialsheaders will be set.For non-authenticated requests, specify the value *. This will cause the
Access-Control-Allow-Originheader to be set, butAccess-Control-Allow-Credentialswill befalseand all user-specific data will be restricted.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URI (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- Type: boolean (details)
- uselang
Language to use for message translations. action=query&meta=siteinfo&siprop=languages returns a list of language codes. You can specify user to use the current user's language preference or content to use this wiki's content language.
- Default: user
- variant
Variant of the language. Only works if the base language supports variant conversion.
- errorformat
Format to use for warning and error text output
- plaintext
- Wikitext with HTML tags removed and entities replaced.
- wikitext
- Unparsed wikitext.
- html
- HTML
- raw
- Message key and parameters.
- none
- No text output, only the error codes.
- bc
- Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
- One of the following values: bc, html, none, plaintext, raw, wikitext
- Default: bc
- errorlang
Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.
- Default: uselang
- errorsuselocal
If given, error texts will use locally-customized messages from the MediaWiki namespace.
- Type: boolean (details)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 10 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
- Help for the main module.
- api.php?action=help [open in sandbox]
- All help in one page.
- api.php?action=help&recursivesubmodules=1 [open in sandbox]
Other APIs
If you do not find what you are looking for in this API documentation, there are many other APIs related to Wikimedia projects.
For the REST API included with MediaWiki 1.35 and later, see API:REST API.
| API | Availability | URL base | Example |
|---|---|---|---|
| Included with MediaWiki
Enabled on Wikimedia projects |
/api.php | https://en.wikipedia.org/w/api.php?action=query&prop=info&titles=Earth | |
| Included with MediaWiki 1.35+
Enabled on Wikimedia projects |
/rest.php | https://en.wikipedia.org/w/rest.php/v1/page/Earth | |
| Not included with MediaWiki
Available for Wikimedia projects only |
/api/rest | https://en.wikipedia.org/api/rest_v1/page/title/Earth | |
Code stewardship
- Maintained by MediaWiki Interfaces Team.
- Live chat (IRC): #mediawiki-core connect
- Issue tracker: Phabricator MediaWiki-Action-API (Report an issue)